Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255728.1 | internal | 111 | 3-335(+) |
Amino Acid sequence : | |||
KIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKILKGTFDFRPGMISIHFGLAIGATTVRF | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,803.069 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 44.710 | ||
aromaticity | 0.036 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.297 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255728.1 | internal | 111 | 335-3(-) |
Amino Acid sequence : | |||
EPYGCCPYCKSKVDGDHPGPKVESSLQDLQDLLIWDLPGAVRVDKDGQRLWHSDGVRDLHNAPPCEPVCHNALGRLPHDVGTAPVDLGGVLPGESTTAMGTPPTIGVDDDL | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,803.069 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 44.710 | ||
aromaticity | 0.036 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.297 | ||
sheet | 0.198 |