Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255733.1	internal	161	3-485(+)
Amino Acid sequence :
ADRLYRVMRFLAYHGIFKRTKPPHESTGGGSVYYAQTPVSRRLTRENLGPFVLLQGTMREPSGCVTAETLRTSKRPGVVDENESDRLYDDPVFSMKVFRDAMAXHAMMTTAGVIENYGEG FPRVGSLVDVCGSYGMALSMLVKAFPGFRGYASSPPNVLGG
Physicochemical properties
Number of amino acids:		161
Molecular weight:		17,550.902
Theoretical pI:		9.200
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11920 12045
Instability index:		37.346
aromaticity		0.100
GRAVY		-0.234
Secondary Structure Fraction
Helix		0.281
turn		0.281
sheet		0.244