Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255736.1 | 5prime_partial | 147 | 3-446(+) |
Amino Acid sequence : | |||
TETSSTTTLWVLAELMRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSQDF MGNDFEFVPFGAGRKICPRLNFRFANF* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 17,166.664 | ||
Theoretical pI: | 8.468 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
Instability index: | 30.268 | ||
aromaticity | 0.116 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.211 | ||
sheet | 0.252 |