| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255736.1 | 5prime_partial | 147 | 3-446(+) |
Amino Acid sequence : | |||
| TETSSTTTLWVLAELMRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSQDF MGNDFEFVPFGAGRKICPRLNFRFANF* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 17,166.664 | ||
| Theoretical pI: | 8.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 30.268 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.211 | ||
| sheet | 0.252 | ||