Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255739.1	5prime_partial	138	3-419(+)
Amino Acid sequence :
PDHGFGNCFTLAPAMASNEEEAEEDGVLVSRLRATIRGVDEDYIKAISDDEFIKEVLGQIGDFFQPGNCIFTSWLRFPLYEVDFGWGKLVRVCTATMPYMNLVILMDTPSGDGIQAWVYV PDDKFFALLEAHCHKNLS*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		15,500.428
Theoretical pI:		4.403
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22710
Instability index:		34.020
aromaticity		0.123
GRAVY		-0.014
Secondary Structure Fraction
Helix		0.341
turn		0.210
sheet		0.261