Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255745.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
AIVTGGSGGIGLETARVLALRNARVIIAARNMDSANEAKQLILESNKTARVHVLKLDLASFKSVKAFADSFISLDLPLNILINNAGIMFCPYQLSQDGIEIQFAXNYLGHFYLTNLLLEK MKETANGTGIQGRI | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,421.577 | ||
Theoretical pI: | 8.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 32.020 | ||
aromaticity | 0.068 | ||
GRAVY | 0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.233 | ||
sheet | 0.316 |