| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255745.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
| AIVTGGSGGIGLETARVLALRNARVIIAARNMDSANEAKQLILESNKTARVHVLKLDLASFKSVKAFADSFISLDLPLNILINNAGIMFCPYQLSQDGIEIQFAXNYLGHFYLTNLLLEK MKETANGTGIQGRI | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,421.577 | ||
| Theoretical pI: | 8.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 32.020 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.233 | ||
| sheet | 0.316 | ||