Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255748.1	internal	196	1-588(+)
Amino Acid sequence :
QLLAAHSVLTCRVETPPSRRRRYSLAAVCEFLTIDEDGASLAPLSLLVQDRVFIESWYHLKDVIVEGGVAFERAYGVHAFEYHAKDPKFNKIFNQAMHNQSIIFMKRILEIYKGFEGVKS LVDVGGGTGASSKMIVSKYPLIKGSNFDLPPVIPDASPPQEWNPLGGDMFVSVPKGKLFFSIGLPRLERETRPEMF
Physicochemical properties
Number of amino acids:		196
Molecular weight:		21,944.132
Theoretical pI:		7.947
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20065
Instability index:		46.917
aromaticity		0.107
GRAVY		-0.071
Secondary Structure Fraction
Helix		0.342
turn		0.250
sheet		0.250