| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255757.1 | 5prime_partial | 185 | 2-559(+) |
Amino Acid sequence : | |||
| EDAYSLTPASRLLLRSEPLSVAPFALAMSDPVYTETWHHLSEWFRNDAVAAFDTKYGMTFPEYAVADDRLNVLFNEAMACDAGFVNSILTTECREIFDGLESMVDVGGGTGATAKGIAAA FPGMECTVLDLPNVVGGLKGSXNLSFVSGDMFDFIPHADAIFMKFILHDWNDKECVKILKKCQEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 12,362.088 | ||
| Theoretical pI: | 11.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.404 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.350 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255757.1 | complete | 151 | 472-17(-) |
Amino Acid sequence : | |||
| MRNKIKHVPTNKAQIXRSLEATYNVWKVKHSTFHPGEGGGDPLRRGSGAAADINHRFQAIEDLSTLRSENTIHKARITSHSLIEQHIQPIVSHRVLRECHPVFGIERSHSIVAEPFAQMV PCLRVDGVRHGERERRHAQGLAPQQEARSWS* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 12,362.088 | ||
| Theoretical pI: | 11.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.404 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.350 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255757.1 | complete | 118 | 453-97(-) |
Amino Acid sequence : | |||
| MSPLTKLRXSDPLRPPTTFGRSSTVHSIPGKAAAIPFAVAPVPPPTSTIDSKPSKISLHSVVRILFTKPASQAIASLNNTFNLSSATAYSGNVIPYLVSNAATASLRNHSLRWCHVSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,362.088 | ||
| Theoretical pI: | 11.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.404 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.350 | ||
| sheet | 0.205 | ||