| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255758.1 | 5prime_partial | 158 | 2-478(+) |
Amino Acid sequence : | |||
| IRSRDGLERVSIDNPRATVAALKSEIESQLRVPVQAQILSTNQSLLLAKTQADLTRFTDMIDPHTGLAALNIGHGSVVYLAYEGERTVAGPAFHPSGSFGKKMTMDDLIAKQMRISHQEN PHCELVSFDRDAANAFHHYVNESLAFAVKPGVSCFGSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 14,333.260 | ||
| Theoretical pI: | 10.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 28.654 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.236 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255758.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
| NSQPRRIGAGLNRQPTRHRRRAQVGDRIPAPGARTSPNSVHQPKFASCENPSRSDPVHGHDRPAHRIGCPQHRPWLRCLSRLRRRTDGGGPGLPSLGVVREENDDGRLDCEADEDLAPGK PSLRTRVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,333.260 | ||
| Theoretical pI: | 10.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 28.654 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.236 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255758.1 | complete | 127 | 415-32(-) |
Amino Acid sequence : | |||
| MVERIRSIAIKGHEFAMRVFLVRDPHLLRNQVVHRHFLPERPRGMEGRARHRPFAFVGEIDNGAMADVEGSQSGVRVDHVREPGQIGLGFRKKQTLVGGQNLGLYGHPELGFDLRLERGD GGAWVVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,333.260 | ||
| Theoretical pI: | 10.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 28.654 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.236 | ||
| sheet | 0.244 | ||