Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255759.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
KVKMVADEEVRVRAEAWNNAFGYIKPTAVATAVELGLPDILENHDGPMSLLELSAATDCPAEPLHRLMRFLVFHGIFKKTAKPPLSNEAVYYARTGLSRLFTKDELGDFMLLQTGPLSQH PAGLTASSLKTGNPSSSGLSTEKTPGPTGHGYHMKVFSDAMGGHPRRQRGDRPFLSCRHSKGI | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 19,926.584 | ||
Theoretical pI: | 9.147 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 31.822 | ||
aromaticity | 0.071 | ||
GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.273 | ||
sheet | 0.284 |