Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255760.1 | 5prime_partial | 171 | 1-516(+) |
Amino Acid sequence : | |||
PVFSMKVFRDAMASHARMTTAAVIENYGEGFQGVGSLVDVGGSYGMALSMLVKAFPWLRGICFDLPEVVARASPLKGVEFVGGTMFENIPKADVVMLMFVLHNWSDEECVEILKRCKDAL SKDKGKVIIIDAVVHQNSDGDEFTGAPLGLDVTIMRLCSREGTDLLQWLFY* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 18,798.686 | ||
Theoretical pI: | 5.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 30.401 | ||
aromaticity | 0.094 | ||
GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.211 | ||
sheet | 0.281 |