Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255762.1	5prime_partial	162	3-491(+)
Amino Acid sequence :
KMACRIALRNVILTELRLPLPSINHNFCSFRPIKTISTSNLSCGCKISLNSKGYQFSRYCSNKGDSSSSTDDSDQAPPQEAVLKAISEVSKAEGRVGQTTNVVIGGTVTDDSTNEWLSLD QKVNSYPTVRRFTANGTGSYDFVQPWLLLLNQYFQCPSLKVN*
Physicochemical properties
Number of amino acids:		162
Molecular weight:		17,862.971
Theoretical pI:		8.779
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18825
Instability index:		41.565
aromaticity		0.080
GRAVY		-0.335
Secondary Structure Fraction
Helix		0.290
turn		0.309
sheet		0.173