| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255769.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
| RPKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNVKSYNLSGMGCSAGLISIDLARDLLQVHPNSHALVISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDAGRAKYKLVSR RPDPPRGCDDKV | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,559.847 | ||
| Theoretical pI: | 9.734 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 48.353 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.295 | ||
| sheet | 0.235 | ||