Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255769.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
RPKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNVKSYNLSGMGCSAGLISIDLARDLLQVHPNSHALVISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDAGRAKYKLVSR RPDPPRGCDDKV | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,559.847 | ||
Theoretical pI: | 9.734 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 48.353 | ||
aromaticity | 0.053 | ||
GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.295 | ||
sheet | 0.235 |