| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255783.1 | internal | 109 | 1-327(+) |
Amino Acid sequence : | |||
| LGSWMIKRLLEDGYYVNATVRLDPERKRNISYITDLPGAAERLQIFNADLDKPETFAPAVEGCGGVFHMAHPLDFAEKETEEVKLKRVSAAMQGILQACADSKTVRRVV | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,178.859 | ||
| Theoretical pI: | 6.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 54.169 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.174 | ||
| sheet | 0.312 | ||