Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255788.1	5prime_partial	204	2-616(+)
Amino Acid sequence :
SELLSARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEELVELVKDALSMASGFELADMFPSSKLLNLLCWNKSKLWRMRRRVDAILEAIVEEH KLKKNGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTSQRGRNIINHHPVGDGGTDEESQSDGKAPAEVKRAEGETDGT*
Physicochemical properties
Number of amino acids:		204
Molecular weight:		14,803.488
Theoretical pI:		11.934
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		81.179
aromaticity		0.015
GRAVY		-1.209
Secondary Structure Fraction
Helix		0.172
turn		0.291
sheet		0.246

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255788.1	3prime_partial	159	477-1(-)
Amino Acid sequence :
MKALMALVVMGTLIWLSFCILKSTSIMSSPPNSPFFLSLCSSTMASRMASTRRRILHSLLLFQQSKLRSLEEGNMSASSNPDAMLRASFTSSTSSSWSLITLPNAALQMMEHVSVAIRSV RSTASPAAAEERRWPRRRDTSSCLMKPKERTLRALRSSE
Physicochemical properties
Number of amino acids:		159
Molecular weight:		14,803.488
Theoretical pI:		11.934
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		81.179
aromaticity		0.015
GRAVY		-1.209
Secondary Structure Fraction
Helix		0.172
turn		0.291
sheet		0.246

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255788.1	5prime_partial	134	1-405(+)
Amino Acid sequence :
LRAPQRPQRPLLRLHQAGRGVPPPRPPPLLGRGGGGRGPHGADSDADVLHHLQGGVRERDQGPRGAGGAGEGRPQHGVRVRARRHVPLLQAPQLALLEQEQAVEDAPPRRRHPRGHRGGA QAQEERRVWRRRHY*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,803.488
Theoretical pI:		11.934
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		81.179
aromaticity		0.015
GRAVY		-1.209
Secondary Structure Fraction
Helix		0.172
turn		0.291
sheet		0.246