| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255799.1 | internal | 221 | 3-665(+) |
Amino Acid sequence : | |||
| LDILIQLKEHHSVQLTWDNIKAVLMDIFIAGTDTGSAAIVWTMTALIKAPNVMKKLQAEIRSLIGKKGKVDEDDLPKLPYLKAVVKESLRLYPPGPLLIPRETMESCALEGYQIQPKTMV YVNAYAVGRDPDYWENPHDFVPERFLNSNIDVKGQDFCLIPFGSGRRMCPGMSMGLANVDLLLPICSTFRLGIASRNSAQDLDTDPMPGLACKKKCLLLVL | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,572.628 | ||
| Theoretical pI: | 6.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25815 | ||
| Instability index: | 34.138 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.222 | ||
| sheet | 0.281 | ||