Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255816.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
GSHAGNKLAMQEFMILPTGASSFKEAMKMGVEVYHHLKAVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAGYTGKVVIGMDVAASEFYGKDKSYDLNFKEENNNGKAKISG DQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAQDDCQMLELTVHIVGDDLLVPNPREFQRL | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,227.518 | ||
Theoretical pI: | 4.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
Instability index: | 33.161 | ||
aromaticity | 0.094 | ||
GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.221 | ||
sheet | 0.271 |