| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255816.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| GSHAGNKLAMQEFMILPTGASSFKEAMKMGVEVYHHLKAVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAGYTGKVVIGMDVAASEFYGKDKSYDLNFKEENNNGKAKISG DQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAQDDCQMLELTVHIVGDDLLVPNPREFQRL | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,227.518 | ||
| Theoretical pI: | 4.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 33.161 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.221 | ||
| sheet | 0.271 | ||