| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255818.1 | complete | 189 | 51-620(+) |
Amino Acid sequence : | |||
| MALTVFSGAMQMPIPSKLTTYLQPSHLNSSPKLLSNTKGTSRSRLRVSCSSSQLTTERRSGNYNPSRWDVDFIQTLHSDYKDEKHARRASELVTLVKMELEKETDQIRQLELIDDLHRMG LSDHFQNEFKEILSSVYLDHGYYKNPDSKEERDLYSPSLAFRLLREHGFQFAQEVFDSFRNEEGEFKKP* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 13,391.360 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 51.559 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.200 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255818.1 | complete | 115 | 470-123(-) |
Amino Acid sequence : | |||
| MVEIYRGQDFFELVLEMIGQPHPVQVINQFKLSNLIRFFLQFHLHQSDQLRSPSRMLLVLIITVERLDKVDIPTRRVVVSGSSFGSELRGGARHTEARSTSTLSVREQFRRRIQV* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,391.360 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 51.559 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.200 | ||
| sheet | 0.217 | ||