| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255839.1 | 5prime_partial | 204 | 3-617(+) |
Amino Acid sequence : | |||
| DVSRVGFTDEFFTEMEPRIQKAFKDMEDLEKGAIANPDEGRMVGHYWLRDPKLAPKAILTQQIESTLERITDFAEQVISGKIKPPLRDRFTQILSIGIGGSALGPQFVAEALAPDNPPLK IRFIDNTDPAGIDHQIAQLGSELESTLVIVVSKSGSTPENKKRLLEVQKAFPRAWXWISQTGSCQFPKKIRCLIIPPRIEGWDT* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,709.812 | ||
| Theoretical pI: | 5.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 31.964 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.227 | ||
| sheet | 0.236 | ||