Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255849.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
DKPPAQLGSSRDYNVDMIPKYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKIHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYKENDPKTHEGMDLSRVTTRELIAKYGLDD NTVDFIGHALALHRDDNYLNEPALETVKRMKLYAES* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,933.385 | ||
Theoretical pI: | 8.652 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 14900 | ||
Instability index: | 26.917 | ||
aromaticity | 0.103 | ||
GRAVY | -0.488 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.179 | ||
sheet | 0.256 |