| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255849.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
| DKPPAQLGSSRDYNVDMIPKYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKIHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYKENDPKTHEGMDLSRVTTRELIAKYGLDD NTVDFIGHALALHRDDNYLNEPALETVKRMKLYAES* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,933.385 | ||
| Theoretical pI: | 8.652 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 14900 | ||
| Instability index: | 26.917 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.179 | ||
| sheet | 0.256 | ||