Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255851.1 | internal | 176 | 2-529(+) |
Amino Acid sequence : | |||
YSSRGFFIFIHPKFGDQNSETRREMNPSEYTAEVTSLSPKATEKDVYDFFAFCGSIDRVEIVRAGEHASTAYVTFKNSHALETAVLLSGATIIDQPVCITRWGHYEDDYNMWNHSSWKIE EESSTNDSQAPRSVPSAGEAVSLAQDVVKTMVSKGYVLGKDAFSKARALDESHQVS | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,614.427 | ||
Theoretical pI: | 5.200 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 44.011 | ||
aromaticity | 0.108 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.244 | ||
sheet | 0.227 |