Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255857.1 | internal | 162 | 3-488(+) |
Amino Acid sequence : | |||
KQAPMADAQRHALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAQQKLLKELNVSENHLVFHQLDVTDPASVAAIAVFVKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADF KALQALEAGAKEEVPFKPKANGEMIEKFEGAKDCVETNYYGP | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 14,562.616 | ||
Theoretical pI: | 5.904 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 56.368 | ||
aromaticity | 0.161 | ||
GRAVY | 0.285 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.234 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255857.1 | 5prime_partial | 124 | 488-114(-) |
Amino Acid sequence : | |||
WTVVVCFHAIFGSLEFFDHFSICFRLKWHFFLCTGFECLKGFEVSLNIFIEDRNISNHLYSANSCIIHQNIKLSEFRFDEDSNSSNASWISNIELMKNQMIFRNIQLLKQLLLSFDASLF ISCS* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,562.616 | ||
Theoretical pI: | 5.904 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 56.368 | ||
aromaticity | 0.161 | ||
GRAVY | 0.285 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.234 | ||
sheet | 0.218 |