| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255861.1 | 5prime_partial | 106 | 380-60(-) |
Amino Acid sequence : | |||
| FLINAILLDRAFAHCPRFPTAAPRGSPGRVSVPVWLIVRKDQLSIIGLVSLNLTNYLIKRRLIKQRFLAFFRIWPELFGRFPRVTNPFATLFSTLLTSWARQATFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,217.351 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 32.905 | ||
| aromaticity | 0.142 | ||
| GRAVY | 0.329 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.217 | ||
| sheet | 0.236 | ||