| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255863.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
| GTIDENSWTDVDFIRSLKAFAGPYIVTKTVAERTAIDLAANLGLDLVSIIPTWVTGPFICPNLPDSVQVAMALILGDPMHYQHLKESSLIHVDDVSRAHIHLLEFPEANGRYICVGHRVQ YRGAFAIFFSGWIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,851.861 | ||
| Theoretical pI: | 5.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 23.327 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.216 | ||
| sheet | 0.231 | ||