Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255866.1 | 5prime_partial | 100 | 1-303(+) |
Amino Acid sequence : | |||
LISTQLDETVTNDEIARDLKEHVIKPVIPEKFLDEKTIFHLSPSGRFVIGGPHGDAGLTGRKIIIDTFGGWGAHGSGAFSGKDPTNVDRSGAYVVKAGGQ* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,613.791 | ||
Theoretical pI: | 6.053 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 11.169 | ||
aromaticity | 0.070 | ||
GRAVY | -0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.280 | ||
sheet | 0.170 |