Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255871.1	internal	206	1-618(+)
Amino Acid sequence :
SGPAGXTIHVNIHVEAIVNFAGMGQNLLKPILXAEGPDPFSFHLYFAHCGTLATASLNKGGMWCVPVSPVNLAVYKPKGTSGTLEFNEAFVSKNHNWLHYMSTCTAYWRGTLTYELRVTY KGSQFCCCKFVCFLYHSNGRTFGFSDKAIGDTGITSVCGDCFSVRFLSLLLLPSLVANYRNIFDIQTSCNGACILVCLLKVLLCSL
Physicochemical properties
Number of amino acids:		206
Molecular weight:		22,303.705
Theoretical pI:		8.405
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28420 29170
Instability index:		31.427
aromaticity		0.123
GRAVY		0.354
Secondary Structure Fraction
Helix		0.358
turn		0.265
sheet		0.221