Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255877.1	complete	144	78-512(+)
Amino Acid sequence :
MKIVYQFILSIYENYERDAMKLGKSFAAPYFKDTVKQLARAFNEELKWVMERQLPSFQDYIKNSEITSCIYIMFASIIPGLKSVTQETIDWVKSEPMLATPTAMIGRYWNDIGSQHRESK GGEMLTALGFSHETTWFDKGRSGV*
Physicochemical properties
Number of amino acids:		144
Molecular weight:		16,625.922
Theoretical pI:		6.736
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32430 32430
Instability index:		22.805
aromaticity		0.132
GRAVY		-0.300
Secondary Structure Fraction
Helix		0.319
turn		0.208
sheet		0.250