Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255887.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
YNWNRVKLRYCDGASFAGDAIFDNGTSLLYFRGQRIWQAIIHDLLPKGLSQANKALLSGCSAGGLATFLHCDNFTSYLPKNASVKCLSDAGFFLDARDISMNHSMRYFFESVVSLQGVAK NLNKNCTSSVYPELCFFPQYVLPYIQTPIFILNTAYDVYQFHHILVPPAADPNGHWYHCKLSPTLQHSPNCYFTRIQEILLETLHHFYSL | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,905.039 | ||
Theoretical pI: | 7.744 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36370 | ||
Instability index: | 39.538 | ||
aromaticity | 0.148 | ||
GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.248 | ||
sheet | 0.219 |