| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255887.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
| YNWNRVKLRYCDGASFAGDAIFDNGTSLLYFRGQRIWQAIIHDLLPKGLSQANKALLSGCSAGGLATFLHCDNFTSYLPKNASVKCLSDAGFFLDARDISMNHSMRYFFESVVSLQGVAK NLNKNCTSSVYPELCFFPQYVLPYIQTPIFILNTAYDVYQFHHILVPPAADPNGHWYHCKLSPTLQHSPNCYFTRIQEILLETLHHFYSL | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,905.039 | ||
| Theoretical pI: | 7.744 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36370 | ||
| Instability index: | 39.538 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.248 | ||
| sheet | 0.219 | ||