Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255889.1	3prime_partial	204	65-676(+)
Amino Acid sequence :
MGKIKIGINGFGRIGRLVARVALQRDDVELVAINDPFISTDYMTYMFKYDSVHGQWKHNDVKVHDEKNLLFGEKPVRIFGCRNPEEIPWAEAGAEFVVESTGVFTDKDKAAAHLKGGAKK VVISAPSKDAPMFVVGVNEKEYSLSTTLFPTPVAPPIALPHWPRSSTKGLALLKVHEHCPLYYRPQKMLMVPQPGWKSWKTAPS
Physicochemical properties
Number of amino acids:		204
Molecular weight:		18,667.088
Theoretical pI:		6.081
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38750
Instability index:		45.966
aromaticity		0.073
GRAVY		-0.087
Secondary Structure Fraction
Helix		0.352
turn		0.224
sheet		0.236

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255889.1	complete	165	547-50(-)
Amino Acid sequence :
MGQGNWWCNWRWKQCRTQAVFLFVHTHNKHGSIFARGGDHNLLGTTLQMSSSLILVGEDSSRFNNKLSTSFCPWDLLWVPASKDSDRLLTEEKVLLVVHLHIVVLPLAVHTVILEHVCHV IGADEWVVNSNKLHIVPLQRNPRDQTADPAESVDPDLDLAHLLDS*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		18,667.088
Theoretical pI:		6.081
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38750
Instability index:		45.966
aromaticity		0.073
GRAVY		-0.087
Secondary Structure Fraction
Helix		0.352
turn		0.224
sheet		0.236