Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255897.1	internal	195	3-587(+)
Amino Acid sequence :
GAEFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEKEYKPEYDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSS TGAAKAVGKVLPALNGKLNGMSFRVPTVDVSVVDLPVRLEKEGTYEEIKAAIQEESENKLQGILGYLKIFGSTDF
Physicochemical properties
Number of amino acids:		195
Molecular weight:		12,891.026
Theoretical pI:		5.002
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		45.505
aromaticity		0.117
GRAVY		0.594
Secondary Structure Fraction
Helix		0.350
turn		0.283
sheet		0.342

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255897.1	complete	120	424-62(-)
Amino Acid sequence :
MPFNFPFKAGSTFPTALAAPVLLGIMLNEAALPPLQSLLDGPSTVFWVAVIEWTVVMRPSTMPNLSLMTLANGARQLVVQLAFETMSYSGLYSFSFTPTTNMGASLLGAEITTFLAPPFK *
Physicochemical properties
Number of amino acids:		120
Molecular weight:		12,891.026
Theoretical pI:		5.002
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		45.505
aromaticity		0.117
GRAVY		0.594
Secondary Structure Fraction
Helix		0.350
turn		0.283
sheet		0.342