| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255912.1 | 5prime_partial | 108 | 465-139(-) |
Amino Acid sequence : | |||
| GEEMCGGITFNNTAFFVDKEFGEVPFYTIPEKPTFNRLQVLVEWSSTGAIDINLVEYWIFGLKTSASKLLNFFIGSGLLRTKLIAGKCQYLQALILVFLIQLCQFCVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,182.181 | ||
| Theoretical pI: | 5.292 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 16.389 | ||
| aromaticity | 0.148 | ||
| GRAVY | 0.531 | ||
Secondary Structure Fraction | |||
| Helix | 0.435 | ||
| turn | 0.204 | ||
| sheet | 0.250 | ||