Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255947.1 | internal | 128 | 3-386(+) |
Amino Acid sequence : | |||
ALSMLVKAFPWLRGICFDLPEVVARASPLKGVEFVGGTMFESIPKADVVMLMFVLHNWSDEECVEILKRCKDAVSKDKGKVIIIDAVIDEDGDGDEFTGARLGLDVTMMATMFEGRERTY VQWARIIN | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,315.576 | ||
Theoretical pI: | 4.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 26.055 | ||
aromaticity | 0.086 | ||
GRAVY | 0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.164 | ||
sheet | 0.289 |