Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255949.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
ARAAMAEVQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVQMVGDVSVFNEYIEADF KALQALEAGAKEEPPFKPKANGEMIEKF | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,164.546 | ||
Theoretical pI: | 8.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 24.949 | ||
aromaticity | 0.068 | ||
GRAVY | 0.013 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.189 | ||
sheet | 0.338 |