| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255950.1 | 3prime_partial | 128 | 3-386(+) |
Amino Acid sequence : | |||
| MAPEEDSLALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPVSIPELATAVDCSADRIYRVMRFLAYHGIFKRTKPPPESTEGGSVYYAQTPVSRRLTKENLGPFVLLQGTMREPSG CVTAGDLE | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,983.802 | ||
| Theoretical pI: | 5.220 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 44.471 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.242 | ||
| sheet | 0.297 | ||