Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255952.1 | 3prime_partial | 156 | 27-494(+) |
Amino Acid sequence : | |||
MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYNLFKIQ DKDVPLSYYVGILGMPAMTAYAGFFEICSPKKGETV | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,324.908 | ||
Theoretical pI: | 5.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 36.566 | ||
aromaticity | 0.103 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.282 | ||
sheet | 0.231 |