Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255953.1 | internal | 163 | 2-490(+) |
Amino Acid sequence : | |||
TTLWVMAELMRNPEVMAKAQAEVRAALKGKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECEVNGYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSKDFMGNDFE FIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMNLP | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 11,272.767 | ||
Theoretical pI: | 8.045 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.028 | ||
aromaticity | 0.081 | ||
GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.242 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255953.1 | 5prime_partial | 99 | 490-191(-) |
Amino Acid sequence : | |||
RKVHSFRQLPVEVVKKLCQWDFNICQPEIQTGADSSSRSKRDELEIVSHEILRDLVKPFGPKGLGFFPVERIPTHGPHVDHDSGLIRNRVPVDLAFFSA* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,272.767 | ||
Theoretical pI: | 8.045 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.028 | ||
aromaticity | 0.081 | ||
GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.242 | ||
sheet | 0.172 |