Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255954.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
TTLWVMAELMRNPEVMAKAQAEVRAALKGKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECEVNGYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSKDFMGKRFR | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,250.506 | ||
Theoretical pI: | 9.197 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
Instability index: | 34.901 | ||
aromaticity | 0.100 | ||
GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.192 | ||
sheet | 0.275 |