| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255963.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| FLEGRVNEGGVDGDLLTRIAYSLDIPLHXRINRPNAPVWIEWYRKRPDMNPVVLDLAILXLNIVQAQFQEELKESFTWWRNTGFVEKLPFARDTLVECYFWNTGIXEPRQHASARIMMG | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,602.458 | ||
| Theoretical pI: | 5.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 38.611 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.207 | ||
| sheet | 0.267 | ||