Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255963.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
FLEGRVNEGGVDGDLLTRIAYSLDIPLHXRINRPNAPVWIEWYRKRPDMNPVVLDLAILXLNIVQAQFQEELKESFTWWRNTGFVEKLPFARDTLVECYFWNTGIXEPRQHASARIMMG | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,602.458 | ||
Theoretical pI: | 5.665 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
Instability index: | 38.611 | ||
aromaticity | 0.121 | ||
GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.207 | ||
sheet | 0.267 |