| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255966.1 | internal | 158 | 3-476(+) |
Amino Acid sequence : | |||
| KDYKTGYSYFFEAFEAFNTLGDPQAIFGLKYMLLCKIMVNQAEDVAGIISSPKVGLQYKGPELDAMKAIADAHSKRSLKLFETALQNFKTELDEDPIVHRHLSALYDTLQEQNLCRLIEP FSRVEIAHIAELIELPSHQVEKKLSQMILDKKFAGTLD | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,938.472 | ||
| Theoretical pI: | 5.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 43.021 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.184 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.165 | ||
| sheet | 0.323 | ||