Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255966.1 | internal | 158 | 3-476(+) |
Amino Acid sequence : | |||
KDYKTGYSYFFEAFEAFNTLGDPQAIFGLKYMLLCKIMVNQAEDVAGIISSPKVGLQYKGPELDAMKAIADAHSKRSLKLFETALQNFKTELDEDPIVHRHLSALYDTLQEQNLCRLIEP FSRVEIAHIAELIELPSHQVEKKLSQMILDKKFAGTLD | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,938.472 | ||
Theoretical pI: | 5.548 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 43.021 | ||
aromaticity | 0.095 | ||
GRAVY | -0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.165 | ||
sheet | 0.323 |