Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255967.1 | 3prime_partial | 145 | 3-437(+) |
Amino Acid sequence : | |||
MANVQRYALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAHQRLLKELNISKNHLVFHQLDVTDPASIAAVAVFIKSTFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFNALQ ALEAGAKEEPPFKPKANGEMIEKFE | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,854.067 | ||
Theoretical pI: | 5.667 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 29.965 | ||
aromaticity | 0.069 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.207 | ||
sheet | 0.317 |