| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255972.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
| HRRYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVTLDQLKAPELLYKSLAAKLIVGMPFKDLATVDSILVRELPPQDDKNARLALKRLIDISMGVITPLSEQLTKPLPNALVLVT LK | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,761.996 | ||
| Theoretical pI: | 9.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 39.606 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.180 | ||
| sheet | 0.303 | ||