Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255975.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
FPSQNKIRSQPFSFSTLHAHCRRCRLAHSRHRRPKSAVLGRHRGRHRQISEEIHPNKAAGDCIRAHAPPHLRRPSHHRLRPMLGGVRARRRRPEPSHGCRRGDSSHARGSLRPRAPPSNR WVEGRIQARNPAQVRAERPTPHRX | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,135.265 | ||
Theoretical pI: | 8.537 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 54.657 | ||
aromaticity | 0.056 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.210 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255975.1 | internal | 143 | 2-430(+) |
Amino Acid sequence : | |||
FPLKTRSDLSRSPSARCMPTAVAAVLPTLATAAQNQPYWAAIEADIDRYLKKSIPIRPPETVFGPMHHLTFAAPATTASALCLAACELVGGDRNQAMAAAAAIHLMHAAAYAHEHLPLTD GSKAESKPAIQHKYGPNVQLLTG | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,135.265 | ||
Theoretical pI: | 8.537 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 54.657 | ||
aromaticity | 0.056 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.210 | ||
sheet | 0.364 |