Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255982.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
KNMSLITDEIRSAASEMYRGDEICQEKSKFLLTEMGLPNGLLPMKDIVEVGYVKDTGFVWLIQKKKCDHRFEKIGRPVQYGVEVTAYVEQKRIKKLTGVKAKGAHDVAHHLRYLRRRTPH REDHLQEPHRLLPLFSGV | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,254.104 | ||
Theoretical pI: | 4.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 44.941 | ||
aromaticity | 0.023 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.233 | ||
sheet | 0.353 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255982.1 | 5prime_partial | 133 | 415-14(-) |
Amino Acid sequence : | |||
DTGKEREKPVGLLKVIFPVGGSSTEISQMVSHIMSSLGLDAGELLDPLLLHVGGDLDAVLNRPPDLLEPVVALLLLDEPDEAGVLHVADLHDVLHGEEAVGQPHFRQEELRFLLADLVAP VHLRRGGSDLIGD* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,254.104 | ||
Theoretical pI: | 4.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 44.941 | ||
aromaticity | 0.023 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.233 | ||
sheet | 0.353 |