Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255989.1	internal	140	2-421(+)
Amino Acid sequence :
FMSRYRGPRFKKIRRLGALPGLTNKRPKAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKYVHIAGKAKGSTGQVLLQLLEMRLDNILFRLGMASTIPAARQLVNHRHILVN GRIVDIPSYRCKPRDIIMAK
Physicochemical properties
Number of amino acids:		140
Molecular weight:		16,221.032
Theoretical pI:		11.499
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7450
Instability index:		50.327
aromaticity		0.064
GRAVY		-0.561
Secondary Structure Fraction
Helix		0.300
turn		0.214
sheet		0.243