| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255993.1 | internal | 148 | 2-445(+) |
Amino Acid sequence : | |||
| LSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDENLLTRIAYSLEIPLHWRIKRPNAPVWIDSYRKRPNMNPVVLDLAILDLNIVQAHFQQELKESFRWWRNTGFVE KLPFARDRLVECYFWNTGIIEPRQHASA | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 17,349.458 | ||
| Theoretical pI: | 5.440 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 45.188 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.196 | ||
| sheet | 0.304 | ||