| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255995.1 | internal | 117 | 353-3(-) |
Amino Acid sequence : | |||
| WTIYNSRIHCHYRHPLCSSVQRNLIRYNLRFLILSTEMLSSMNLRLVGNVPIRRSQCEERRRINNLLDRLSLLVRLQDIPQSSNINRSESVRIRNPGLDKSGSVEDDVAAARAEFGT | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,706.175 | ||
| Theoretical pI: | 5.212 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 17.675 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.214 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255995.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
| RAEFGTSGCHVVFHTAALVEPWIPDPDRFTSVNVGGLRNVLKAYQETQTIEKIVYTSSFFALGPTDGYIADESQVHTAKHFCTEYEKSKVISDKIALDAAAEGVPIVAVYPGVVYGP | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,706.175 | ||
| Theoretical pI: | 5.212 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 17.675 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.214 | ||
| sheet | 0.214 | ||