Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255996.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
EVPFKPKANGEMIEKFEGAKDCVETNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKERKLEEIQWPPHFAAERVSKAALNAY TKIVAKKYPSFRINAICPGYAKTDITFHAGPLSVAEAAQ | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 12,111.026 | ||
Theoretical pI: | 10.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 59.578 | ||
aromaticity | 0.150 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.180 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255996.1 | complete | 105 | 399-82(-) |
Amino Acid sequence : | |||
MRKLGYFFATILVYAFNAAFETLSAAKCGGHWISSSLRSFISLRKTSTTSSTLSSVSLSSSPSTPFAHSFHKSSKLPKEEETLTILGEGDNCKRGMRACVSLFGP* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,111.026 | ||
Theoretical pI: | 10.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 59.578 | ||
aromaticity | 0.150 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.180 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255996.1 | 5prime_partial | 100 | 478-176(-) |
Amino Acid sequence : | |||
LSSFGHTQWARMEGNVGFRITRAYCIYAETRVLLRHNLSVRVQRRLRNSLRRKMRRPLDFFKLTFFYIFEENLHNFVYSLFCQPILVAEHSLCPFVPQKQ* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 12,111.026 | ||
Theoretical pI: | 10.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 59.578 | ||
aromaticity | 0.150 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.180 | ||
sheet | 0.230 |