| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255996.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| EVPFKPKANGEMIEKFEGAKDCVETNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKERKLEEIQWPPHFAAERVSKAALNAY TKIVAKKYPSFRINAICPGYAKTDITFHAGPLSVAEAAQ | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,111.026 | ||
| Theoretical pI: | 10.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 59.578 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.180 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255996.1 | complete | 105 | 399-82(-) |
Amino Acid sequence : | |||
| MRKLGYFFATILVYAFNAAFETLSAAKCGGHWISSSLRSFISLRKTSTTSSTLSSVSLSSSPSTPFAHSFHKSSKLPKEEETLTILGEGDNCKRGMRACVSLFGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,111.026 | ||
| Theoretical pI: | 10.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 59.578 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.180 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255996.1 | 5prime_partial | 100 | 478-176(-) |
Amino Acid sequence : | |||
| LSSFGHTQWARMEGNVGFRITRAYCIYAETRVLLRHNLSVRVQRRLRNSLRRKMRRPLDFFKLTFFYIFEENLHNFVYSLFCQPILVAEHSLCPFVPQKQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 12,111.026 | ||
| Theoretical pI: | 10.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 59.578 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.180 | ||
| sheet | 0.230 | ||