Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255999.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
HIFLAKFREQVSEEQIEECIKGFADLVDLTPSMKSFKWGKEMAIANFHQDFTHVFETTFESAESVVEYIYHPRHVDFAILFLPRLEKFAVFDFETTTVPS* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,737.188 | ||
Theoretical pI: | 4.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 42.393 | ||
aromaticity | 0.160 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.130 | ||
sheet | 0.270 |