| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256000.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
| RTENLEKRGERNMASTKRWLPLEANPDIMNQFLWGLGVSPDEAECFDVYGLDEELLGMVPQPVLAVLFLYPLTEKSEEERIRQDASTKDSSGGPYFMKQTVGNACGTIGLLHAVGNITSE IKLVEGSYLDKFFKSTAHMDPIERA | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,212.215 | ||
| Theoretical pI: | 4.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 55.729 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.366 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.241 | ||
| sheet | 0.310 | ||