Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256000.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
RTENLEKRGERNMASTKRWLPLEANPDIMNQFLWGLGVSPDEAECFDVYGLDEELLGMVPQPVLAVLFLYPLTEKSEEERIRQDASTKDSSGGPYFMKQTVGNACGTIGLLHAVGNITSE IKLVEGSYLDKFFKSTAHMDPIERA | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,212.215 | ||
Theoretical pI: | 4.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 55.729 | ||
aromaticity | 0.083 | ||
GRAVY | -0.366 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.241 | ||
sheet | 0.310 |