Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256002.1 | internal | 156 | 2-469(+) |
Amino Acid sequence : | |||
QNPYNLFKIQDKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAAGSVGQLVGQFAKMFGCYVVGSAGSKEKVDLLKNKFGFDDAFNYKEESDYDTALKRHFPEGIDIYFDNV GGKMLEAVINNMRVHGRIAVCGMVSQYSLKQPEGVH | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 15,051.517 | ||
Theoretical pI: | 9.241 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
Instability index: | 45.927 | ||
aromaticity | 0.098 | ||
GRAVY | 0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.226 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256002.1 | 5prime_partial | 133 | 469-68(-) |
Amino Acid sequence : | |||
VDAFGLLQAVLGDHPTYRDAAVDSHVVDHSFKHLPSNIVEVYINSFGEVPLQSSIIITLFFIIKCIIEPKFVLQKINLLFAPCTSNNIAPKHLCKLTNKLAHRSCCSRYKNSFAFFRRAN LKKPCICCHPRHS* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,051.517 | ||
Theoretical pI: | 9.241 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
Instability index: | 45.927 | ||
aromaticity | 0.098 | ||
GRAVY | 0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.226 | ||
sheet | 0.188 |