| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256004.1 | internal | 158 | 2-475(+) |
Amino Acid sequence : | |||
| SEKMATNGVVISCLREVRPPMTKHAPSMWTDTFSNFSLDDKEQQKCSETIEALKQEARGMLMAATTPLQQMTLIDTLERLGLSFHFETEIEYKIELINAAEDDGFDLFATALRFRLLRQH QRHVSCDVFDKFIDKDGKFEESLSNNVERLLSLYEAAH | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 18,163.407 | ||
| Theoretical pI: | 5.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 47.615 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.158 | ||
| sheet | 0.329 | ||