Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256004.1 | internal | 158 | 2-475(+) |
Amino Acid sequence : | |||
SEKMATNGVVISCLREVRPPMTKHAPSMWTDTFSNFSLDDKEQQKCSETIEALKQEARGMLMAATTPLQQMTLIDTLERLGLSFHFETEIEYKIELINAAEDDGFDLFATALRFRLLRQH QRHVSCDVFDKFIDKDGKFEESLSNNVERLLSLYEAAH | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 18,163.407 | ||
Theoretical pI: | 5.018 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 47.615 | ||
aromaticity | 0.082 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.158 | ||
sheet | 0.329 |